• The attached
    • News
    • Futures / Vintages
    • Wine personalities
    • Wine in China
  • Auction market
    • Market trends
    • The best hammer
  • Buy / Sale
    • Current sales
    • Archives of sales
    • iDealwine, instructions
  • Tastings & agreements
    • Accords mets/vins
    • Our tastings
    • Our tips for taste
    • The recipe of the week
  • Learn
    • How is wine ?
    • How to talk about wine
    • Tips and Tricks
    • Grapes
    • Bio, Biodynamics, etc..
  • Appellations & areas
    • Focus on wine, domain
    • Designations and classifications
  • All + far
    • Our good addresses
    • Economie du vin
    • Wine and health
    • Publications
    • History of the vine
  • Home Blog
  • Access iDealwine.com
  • Contact

2

Names and areas · Focus on wine, domain

St. Préfert : a new Star in Chateauneuf-du-Pape

  • by Writing iDealwine
  • 20 October 2011 at 10h35 am

 

Chateauneuf, This is of course institutions like Rayas, Beaucastel or the Clos des Papes. But it is also a name that moves and renewed. The recent resumption of field St. Préfert by Isabel Ferrando is a good example.

The history of St. Préfert begins with the family when in Serre 1920, a great wine connoisseur, Fernand Serre, pharmacist in Avignon, discovers that a district Chateauneuf bears his name : the district of Serres. Lover of fine wines and apothecary, near it acquires 80 hectares in the district of the southern slope of the village. His secret desire : become winemaker. He built a winery and a house in the center of vines and soon learns the methods of winemaking. The Domain St. Préfert was born. Excellent winemaker, Fernand Serre was a pioneer in the events that built the reputation of the appellation 1998 Châteauneuf-du-Pape. St. Préfert was one of the first areas of Chateauneuf marketing its wine bottles from 1930 and conquer distant markets.

If the history of St. Préfert begins with that of Fernand Serre, legend is born 2002 Isabel Ferrando, a native banker in the region, converted into the profession of winemaker. At that time, she bought the 13 remaining acres of the original property and rolls up his sleeves. The rest is history, a success because since its first vintage in 2003, his wines continue to see their ratings go up. For 2004, it acquires 2 hectares to its name, on sandier soils, the Estate Colombis. And two years ago, a plot of 1,5 ha, “Cristia” complements both fields.

Mediterranean heart and blood, Isabel ensures the tradition surrounding himself with the best techniques winemaking, to perpetuate the expertise and reputation of the origins of the field, while being anchored in modernity. It is thus recommended by the inevitable oenologist Philippe Cambie, leading figure of Rhône Valley South. The local of Saint Préfert extends on the left bank of Rhône Valley, between Orange and Avignon, around a building from the thirties and his cellar. Its 13 hectares are very characteristic of the appellation, made of pebbles and gravel filter. In summer, the sun floods the soil generously restores its heat throughout the night ; this alternating heat that occurs in the vineyards explains the depth of wines. Also the Mistral, at the top of its stroke at this point in the Valley Rhône Valley, dry and cleans the vine. It is through this microclimate and low rainfall that the wines here are at their optimum, but not limited. The local, exceptional, also has a role to play. The old vines domain (aged 60 years on average) occur in very small quantities : the average yield is 20 hl / ha and the highly concentrated juice of grapes. So, Bays Grenache, of Syrah, of Mourvedre and Cinsault are dense and sips of sugar ; they are harvested by hand and carefully sorted. The estate wines that express pleasure, This spicy sweetness. Otherwise, in respect of a healthy environment, the field of St. Préfert preserves the vine by promoting the development of "natural defenses" of vineyard. The grapes are vinified in concrete vats and macerated for weeks so that each vine reveals its own flavor. Then the wines are aged 18 months in oak barrels and half barrels in natural cellar dug under the house. Thus are born the four major reserves St. Préfert.

The field St. Préfert : what the press says

The RVF Guide Best of Wines of France 2012

1 on 3

The field St. Préfert is located in the lower village of Chateauneuf-du-Pape, in the area called the Small Greenhouses. A few popular local name of the, but Isabel Ferrando, former banker assisted by her husband, has successfully optimized by careful work, neat and quality in the vineyards. It produces a wine modern, with great regularity, attractive, immediate, extremely silky and refined, which lacks a touch of firmness. From 2009, a beautiful piece on the sector Cristia should bring some more structure on upcoming vintages, Partially fermented in whole bunches in the new cellar.

Bettane Dessauve the Great Wines of France 2012

3 on 5

Within a few years, Isabel Ferrando has led to a remarkable history of this domain name, south sector, in the district of Serres. Two wines from old vines exist, Giraud and Charles Auguste Favier, while another plot produces a wine sold under the name Domaine Isabel Ferrando.

Robert Parker

One of the up and coming superstar estates in Chateauneuf du Pape Is That of Isabel Ferrando's Domaine St. Prefert. Her 2007s are future legends, with one perfect wine (the Collection Charles Giraud), Nearly perfect and Two efforts (Reserve Auguste Favier and the the 100% Grenache cuvee sold from under the label Isabel Ferrando, the Chateauneuf du Pape Colombis).

Discover the wines of the area St. Préfert currently for sale on iDealwine.

Je commande
Drink up 2017
Domaine de Saint-Préfert 

1998 Châteauneuf-du-Pape 2009 – Red

16/20 RVF 

90-92/100 IWC Stephen Tanzer

88-90/100 Robert Parker

15/20 Bettane & Desseauve

property prices 

20.00€ TTC

The bottle – 75cl

Je commande

A delicate wine, elegant and remains fresh in the mouth and easy to drink. Pour viandes rouges grillées 

or poultry (duck, pigeon)

Je commande
Drink up 2020
Domaine de Saint-Préfert 

Chateauneuf-du-Pape 'Reserve Auguste Favier " 2009 – Red

16/20 Bettane & Desseauve

16,5/20 RVF

92-94/100 IWC Stephen Tanzer

91-93/100 Robert Parker

property prices 

30.00€ TTC

The Magnum – 150cl

Je commande

A beautiful bottle combines power and elegance marvelously. A wine of game birds or fungi
Je commande
Drink up 2016
Je commande Domaine de Saint-Préfert 

1998 Châteauneuf-du-Pape 2008 – Red

90/100 Wine Spectator 

89/100 IWC Stephen Tanzer

88/100 Robert Parker

16/20 Jancis Robinson

14,5/20 Bettane & Desseauve

property prices 

38.00€ TTC

The bottle – 75cl

Je commande

A pretty fine material and elegant, almost Burgundian. Idéal pour toutes les viandes blanches 

or roast chicken

Je commande
Drink up 2020
Domaine de Saint-Préfert 

Chateauneuf-du-Pape "Collection Charles Giraud" 2009 – Red

18/20 RVF 

17/20 Bettane & Desseauve

93-95/100 IWC Stephen Tanzer

92-94/100 Robert Parker

property prices 

48.00€ TTC

The bottle – 75cl

Je commande

A rich wine, wide, voluptuous, already delicious. A marriage with meat sauce, poultry tasty, dishes with mushrooms

Tags: BeaucastelChateauneuf1998 Châteauneuf-du-PapeCinsaultClos des PapesColombisGrenacheMourvedreoenologistrayasrhôneSt. PréfertSyrahlocalvinewinemakervinesvineyardwinemaking

 

Like ? Share !

 

2 Comments

  1. CAZAUX says:
    17 April 2013 at 16 h 25 min

    Désolé de ne pouvoir joindre le domaine de Saint prefert que par cette “notation”.
    Ma cave ayant presque totalement disparu après cambriolage, j’ai perdu mes dernères bouteilles de Saint Préfert 2007.
    En reste-t-il en stock de ce millésime? At what price?
    J’espère que vous pourrez me répondre.

    Reply
    • iDealwine says:
      21 April 2013 at 21 h 31 min

      Mr.,
      Nous sommes désolés pour vous de ce qui vous arrive. Sachez que quelques vins du domaine Saint-Préfert sont actuellement disponibles à la vente sur iDealwine dans le millésime 2007, vous pourrez les trouver via ce lien : http://www.idealwine.com/fr/le_marche_search/ok_results.jsp?fastOk=ok&fastKey=prefert
      Cordially,
      L’équipe commerciale d’iDealwine

      Reply

Leave a comment

Click here to cancel reply.

  • Previous story In-room sale 21 October 2011 : bargains to enter !
  • Next story The name Quarter-to-Thatch classified Grand Cru de Loire

    Articles to read as

  • pave_vpf_20130523 Fixed-price sale : Burgundy, the Rhone, the Loire and Italy headliners May 14, 2013
  • montmartre_vignes Paris tries to get his own name to the INAO May 14, 2013
  • AtableVJ copie What agreements on wines from the southern Rhone Valley ? May 1, 2013
  • assiette de morilles Recipe of the Week : sweetbreads with morels April 28, 2013
  • See the articles

    • Recent
    • Popular
    • famille_champagne-fleury_depuis_4_generationsChampagnes Fleury, our heart stroke spring !20 May 2013
    • tagliatelles foie gras,Recipe of the week Tagliatelle with foie gras19 May 2013
    • Vente en salle LyonIn-room sale : 500 Lots, great wines of Bordeaux and Burgundy17 May 2013
    • Famille de SousaDe Sousa : family, Grand terroirs, superb champagnes !16 May 2013
    • notes primeurs 2eme partieRanking of Bordeaux 2012 premiere : top marks great tasters - Part 23 May 2013
    • notes primeurs 1ere partieRanking of Bordeaux 2012 premiere : top marks great tasters - Part 12 May 2013
    • Vignobles de BordeauxFutures 2012 in Bordeaux : first rate, first questions on prices24 April 2013
    • Jean-Michel CommeBiodynamics in Bordeaux : a meeting at the Chateau Pontet Canet7 May 2013
  • Last comments

    • sap in :The vineyards of Condrieu and Côte-Rôtie threatened ?
    • ModeVerre in :The art of tasting : cutting or champagne flute for ?
    • Dumas Martin dans :Good food : Obligatory stop at the station gourmet Labarde, in the Médoc !
    • GUILLAIS in :Our advice to choose the wines you sell
    • Bernadette dance :La Route des Vins de Bordeaux Graves and Sauternes : the new wine tourism attraction
  • Search

  • Video

  • Newsletter


  • team iDealwine

    The team briefly iDealwine
  • Connections

    • Burgundy Live
    • Emmanuel Delmas
    • Jim's Loire
    • Page wine Karine Valentin
    • Journal of wine from France
    • The Blog de Beaucastel
    • Blog Beaurenard
    • The Chateau Brane Cantenac blog
    • Château Palmer's blog
    • Jacques Perrin's Blog
    • The blog of Jean-Luc Thunevin
    • The Blog of Miss Glou Glou
    • The Blog of Miss Vicky Wine
    • The Blog of Edonys TV
    • The Blog of Hervé Bizeul
    • Nicolas Rouyn
    • Oenos
    • Tweetawine
    • Vinblog
    • Wine in Paris
  • indices winedex©

    © WineDex indices to invest and put in wine
  • Our social networks

    • 4915followers
    • 8919likes
    • 2590posts
    • 1077comments
  • Translation

    by Transposh - google translate and bing translate plugin for wordpress
  • Home
  • Names and areas
  • St. Préfert : a new Star in Chateauneuf-du-Pape
        • Home Blog
        • Access iDealwine.com
        • Contact

        ©iDealwine 2013